Lineage for d1up7b1 (1up7 B:1-162)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575610Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)
  6. 575611Protein 6-phospho-beta-glucosidase [110428] (2 species)
  7. 575614Species Thermotoga maritima [TaxId:243274] [110430] (3 PDB entries)
  8. 575624Domain d1up7b1: 1up7 B:1-162 [113376]
    Other proteins in same PDB: d1up7a2, d1up7b2, d1up7c2, d1up7d2, d1up7e2, d1up7f2, d1up7g2, d1up7h2

Details for d1up7b1

PDB Entry: 1up7 (more details), 2.4 Å

PDB Description: structure of the 6-phospho-beta glucosidase from thermotoga maritima at 2.4 angstrom resolution in the tetragonal form with nad and glucose-6-phosphate

SCOP Domain Sequences for d1up7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1up7b1 c.2.1.5 (B:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima}
mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl
isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv
eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglc

SCOP Domain Coordinates for d1up7b1:

Click to download the PDB-style file with coordinates for d1up7b1.
(The format of our PDB-style files is described here.)

Timeline for d1up7b1: