![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
![]() | Protein 6-phospho-beta-glucosidase [110428] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [110430] (3 PDB entries) Uniprot Q9X108 |
![]() | Domain d1up7b1: 1up7 B:1-162 [113376] Other proteins in same PDB: d1up7a2, d1up7b2, d1up7c2, d1up7d2, d1up7e2, d1up7f2, d1up7g2, d1up7h2 complexed with g6p, nad, so4 |
PDB Entry: 1up7 (more details), 2.4 Å
SCOPe Domain Sequences for d1up7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1up7b1 c.2.1.5 (B:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} mriavigggssytpelvkglldisedvridevifydideekqkivvdfvkrlvkdrfkvl isdtfegavvdakyvifqfrpgglkgrendegiplkygligqettgvggfsaalrafpiv eeyvdtvrktsnativnftnpsghitefvrnyleyekfiglc
Timeline for d1up7b1: