![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
![]() | Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (1 family) ![]() |
![]() | Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (3 proteins) Pfam PF01341 |
![]() | Protein Putative cellulase Rv0062 (Cel6, CelA1) [117447] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [117448] (4 PDB entries) |
![]() | Domain d1up2a_: 1up2 A: [113356] complexed with 1pg, act, bgc, ifm, mho, so4 |
PDB Entry: 1up2 (more details), 1.9 Å
SCOP Domain Sequences for d1up2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1up2a_ c.6.1.1 (A:) Putative cellulase Rv0062 (Cel6, CelA1) {Mycobacterium tuberculosis [TaxId: 1773]} anplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvggtvaryt gaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspatiivepda lamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarlndvgvgr argfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwcnpsgral gappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq
Timeline for d1up2a_: