Lineage for d1up2a_ (1up2 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689534Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 689535Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (1 family) (S)
  5. 689536Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (3 proteins)
    Pfam PF01341
  6. 689571Protein Putative cellulase Rv0062 (Cel6, CelA1) [117447] (1 species)
  7. 689572Species Mycobacterium tuberculosis [TaxId:1773] [117448] (4 PDB entries)
  8. 689576Domain d1up2a_: 1up2 A: [113356]
    complexed with 1pg, act, bgc, ifm, mho, so4

Details for d1up2a_

PDB Entry: 1up2 (more details), 1.9 Å

PDB Description: structure of the endoglucanase cel6 from mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom
PDB Compounds: (A:) putative cellulase cel6

SCOP Domain Sequences for d1up2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1up2a_ c.6.1.1 (A:) Putative cellulase Rv0062 (Cel6, CelA1) {Mycobacterium tuberculosis [TaxId: 1773]}
anplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvggtvaryt
gaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspatiivepda
lamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarlndvgvgr
argfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwcnpsgral
gappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq

SCOP Domain Coordinates for d1up2a_:

Click to download the PDB-style file with coordinates for d1up2a_.
(The format of our PDB-style files is described here.)

Timeline for d1up2a_: