Lineage for d1uoza_ (1uoz A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 577009Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 577010Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (1 family) (S)
  5. 577011Family c.6.1.1: Glycosyl hydrolases family 6, cellulases [51990] (3 proteins)
    Pfam 01341
  6. 577045Protein Putative cellulase Rv0062 (Cel6, CelA1) [117447] (1 species)
  7. 577046Species Mycobacterium tuberculosis [TaxId:1773] [117448] (4 PDB entries)
  8. 577047Domain d1uoza_: 1uoz A: [113354]
    complexed with glc, gol, sgc, so4

Details for d1uoza_

PDB Entry: 1uoz (more details), 1.1 Å

PDB Description: structure of the endoglucanase cel6 from mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom

SCOP Domain Sequences for d1uoza_:

Sequence, based on SEQRES records: (download)

>d1uoza_ c.6.1.1 (A:) Putative cellulase Rv0062 (Cel6, CelA1) {Mycobacterium tuberculosis}
ghiegrhmanplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatv
ggtvarytgaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspa
tiivepdalamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaar
lndvgvgrargfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnw
cnpsgralgappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnag
q

Sequence, based on observed residues (ATOM records): (download)

>d1uoza_ c.6.1.1 (A:) Putative cellulase Rv0062 (Cel6, CelA1) {Mycobacterium tuberculosis}
ghiegrhanplagkpfyvdpasaamvaarnanppnaeltsvantpqsywldqafppatvg
gtvarytgaaqaagampvltlygiphrdcgsyasggfatgtdyrgwidavasglgsspat
iivepdalamadclspdqrqerfdlvryavdtltrdpaaavyvdaghsrwlsaeamaarl
ndvgvgrargfslnvsnfyttdeeigygeaisgltngshyvidtsrngagpapdaplnwc
npsgralgappttatagahadaylwikrpgesdgtcgrgepqagrfvsqyaidlahnagq

SCOP Domain Coordinates for d1uoza_:

Click to download the PDB-style file with coordinates for d1uoza_.
(The format of our PDB-style files is described here.)

Timeline for d1uoza_: