Lineage for d1unle_ (1unl E:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644042Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 644043Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 644044Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 644045Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species)
  7. 644046Species Human (Homo sapiens) [TaxId:9606] [74740] (4 PDB entries)
  8. 644048Domain d1unle_: 1unl E: [113327]
    Other proteins in same PDB: d1unla_, d1unlb_
    complexed with rrc; mutant

Details for d1unle_

PDB Entry: 1unl (more details), 2.2 Å

PDB Description: structural mechanism for the inhibition of cd5-p25 from the roscovitine, aloisine and indirubin.
PDB Compounds: (E:) Cyclin-dependent kinase 5 activator 1

SCOP Domain Sequences for d1unle_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unle_ a.74.1.1 (E:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens) [TaxId: 9606]}
qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl
ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv
inlmsskmlqinadphyftqvfsdlknesg

SCOP Domain Coordinates for d1unle_:

Click to download the PDB-style file with coordinates for d1unle_.
(The format of our PDB-style files is described here.)

Timeline for d1unle_: