![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74740] (5 PDB entries) Uniprot Q15078 145-294 |
![]() | Domain d1unld_: 1unl D: [113326] Other proteins in same PDB: d1unla_, d1unlb_ complexed with rrc |
PDB Entry: 1unl (more details), 2.2 Å
SCOPe Domain Sequences for d1unld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1unld_ a.74.1.1 (D:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens) [TaxId: 9606]} qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv inlmsskmlqinadphyftqvfsdlknesg
Timeline for d1unld_: