Lineage for d1unlb_ (1unl B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2980990Protein Cyclin-dependent PK, CDK5 [88857] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2980991Species Human (Homo sapiens) [TaxId:9606] [88858] (5 PDB entries)
    Uniprot Q00535
  8. 2980993Domain d1unlb_: 1unl B: [113325]
    Other proteins in same PDB: d1unld_, d1unle_
    complexed with rrc

Details for d1unlb_

PDB Entry: 1unl (more details), 2.2 Å

PDB Description: structural mechanism for the inhibition of cd5-p25 from the roscovitine, aloisine and indirubin.
PDB Compounds: (B:) cyclin-dependent kinase 5

SCOPe Domain Sequences for d1unlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unlb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp

SCOPe Domain Coordinates for d1unlb_:

Click to download the PDB-style file with coordinates for d1unlb_.
(The format of our PDB-style files is described here.)

Timeline for d1unlb_: