Lineage for d1unla_ (1unl A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 735094Protein Cyclin-dependent PK, CDK5 [88857] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 735095Species Human (Homo sapiens) [TaxId:9606] [88858] (4 PDB entries)
  8. 735096Domain d1unla_: 1unl A: [113324]
    Other proteins in same PDB: d1unld_, d1unle_

Details for d1unla_

PDB Entry: 1unl (more details), 2.2 Å

PDB Description: structural mechanism for the inhibition of cd5-p25 from the roscovitine, aloisine and indirubin.
PDB Compounds: (A:) cyclin-dependent kinase 5

SCOP Domain Sequences for d1unla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp

SCOP Domain Coordinates for d1unla_:

Click to download the PDB-style file with coordinates for d1unla_.
(The format of our PDB-style files is described here.)

Timeline for d1unla_: