![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Cyclin-dependent PK, CDK5 [88857] (1 species) CMGC group; CDKs subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88858] (5 PDB entries) Uniprot Q00535 |
![]() | Domain d1unla_: 1unl A: [113324] Other proteins in same PDB: d1unld_, d1unle_ complexed with rrc |
PDB Entry: 1unl (more details), 2.2 Å
SCOPe Domain Sequences for d1unla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp
Timeline for d1unla_: