SCOP 1.75: Domain d1unhe_: 1unh E:

Lineage for d1unhe_ (1unh E:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74740] (4 PDB entries)
   Uniprot Q15078 145-294

8. Domain d1unhe_: 1unh E: [113323]
   Other proteins in same PDB: d1unha_, d1unhb_
   complexed with ixm; mutant

Details for d1unhe_

PDB Entry: 1unh, 2.35 Å

PDB Description: structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.

PDB Compounds: (E:) Cyclin-dependent kinase 5 activator 1

SCOP Domain Sequences for d1unhe_:

Sequence; same for both SEQRES and ATOM records:

>d1unhe_ a.74.1.1 (E:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens) [TaxId: 9606]}
stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
lmsskmlqinadphyftqvfsdlknesg

Timeline for d1unhe_:

• d1unhe_ first appeared in SCOP 1.71
  
• d1unhe_ appears in SCOP 1.73
  
• d1unhe_ appears in SCOPe 2.01
  
• d1unhe_ appears in the current release, SCOPe 2.08