![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (4 proteins) |
![]() | Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74740] (4 PDB entries) |
![]() | Domain d1unge_: 1ung E: [113319] Other proteins in same PDB: d1unga_, d1ungb_ complexed with alh; mutant |
PDB Entry: 1ung (more details), 2.3 Å
SCOP Domain Sequences for d1unge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1unge_ a.74.1.1 (E:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens)} stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin lmsskmlqinadphyftqvfsdlknesg
Timeline for d1unge_: