Lineage for d1unge_ (1ung E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540337Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 540338Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 540339Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 540340Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species)
  7. 540341Species Human (Homo sapiens) [TaxId:9606] [74740] (4 PDB entries)
  8. 540345Domain d1unge_: 1ung E: [113319]
    Other proteins in same PDB: d1unga_, d1ungb_
    complexed with alh; mutant

Details for d1unge_

PDB Entry: 1ung (more details), 2.3 Å

PDB Description: structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.

SCOP Domain Sequences for d1unge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1unge_ a.74.1.1 (E:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens)}
stsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvflym
lcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsvin
lmsskmlqinadphyftqvfsdlknesg

SCOP Domain Coordinates for d1unge_:

Click to download the PDB-style file with coordinates for d1unge_.
(The format of our PDB-style files is described here.)

Timeline for d1unge_: