Lineage for d1unga_ (1ung A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219248Protein Cyclin-dependent PK, CDK5 [88857] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2219249Species Human (Homo sapiens) [TaxId:9606] [88858] (5 PDB entries)
    Uniprot Q00535
  8. 2219254Domain d1unga_: 1ung A: [113316]
    Other proteins in same PDB: d1ungd_, d1unge_
    complexed with alh

Details for d1unga_

PDB Entry: 1ung (more details), 2.3 Å

PDB Description: structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.
PDB Compounds: (A:) cell division protein kinase 5

SCOPe Domain Sequences for d1unga_:

Sequence, based on SEQRES records: (download)

>d1unga_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
mqkyeklekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkh
knivrlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsr
nvlhrdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklys
tsidmwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpyp
mypattslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp

Sequence, based on observed residues (ATOM records): (download)

>d1unga_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
mqkyeklekiygtvfkaknretheivalkrvrlddddegvpssalreicllkelkhkniv
rlhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlh
rdlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklystsid
mwsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypa
ttslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsdfcpp

SCOPe Domain Coordinates for d1unga_:

Click to download the PDB-style file with coordinates for d1unga_.
(The format of our PDB-style files is described here.)

Timeline for d1unga_: