Lineage for d1unfx2 (1unf X:105-238)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722119Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 722120Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 722121Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 722149Protein Fe superoxide dismutase (FeSOD) [54725] (10 species)
  7. 722196Species Cowpea (Vigna unguiculata) [TaxId:3917] [117897] (1 PDB entry)
  8. 722197Domain d1unfx2: 1unf X:105-238 [113315]
    Other proteins in same PDB: d1unfx1
    complexed with fe

Details for d1unfx2

PDB Entry: 1unf (more details), 1.97 Å

PDB Description: the crystal structure of the eukaryotic fesod from vigna unguiculata suggests a new enzymatic mechanism
PDB Compounds: (X:) iron superoxide dismutase

SCOP Domain Sequences for d1unfx2:

Sequence, based on SEQRES records: (download)

>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]}
ggggkpsgellelierdfgsfekfldefkaaaatqfgsgwawlaykaskldgenaanpps
adednklvvikspnavnplvwggyyplltidvwehayyldfqnrrpdyisvfmdklvswd
avssrleqakalsa

Sequence, based on observed residues (ATOM records): (download)

>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]}
ggggkpsgellelierdfgsfekfldefkaaaatqfgsgwawlaykaskldadednklvv
ikspnavnplvwggyyplltidvwehayyldfqnrrpdyisvfmdklvswdavssrleqa
kalsa

SCOP Domain Coordinates for d1unfx2:

Click to download the PDB-style file with coordinates for d1unfx2.
(The format of our PDB-style files is described here.)

Timeline for d1unfx2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1unfx1