Lineage for d1unfx2 (1unf X:105-238)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) 
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins) 
Protein Fe superoxide dismutase (FeSOD) [54725] (10 species) 
Species Cowpea (Vigna unguiculata) [TaxId:3917] [117897] (1 PDB entry) 
Domain d1unfx2: 1unf X:105-238 [113315]
Other proteins in same PDB: d1unfx1
complexed with fe
Details for d1unfx2
PDB Entry: 1unf (more details), 1.97 Å
PDB Description: the crystal structure of the eukaryotic fesod from vigna unguiculata suggests a new enzymatic mechanism
SCOP Domain Sequences for d1unfx2:
Sequence, based on SEQRES records: (download)
>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata)}
ggggkpsgellelierdfgsfekfldefkaaaatqfgsgwawlaykaskldgenaanpps
adednklvvikspnavnplvwggyyplltidvwehayyldfqnrrpdyisvfmdklvswd
avssrleqakalsa
Sequence, based on observed residues (ATOM records): (download)
>d1unfx2 d.44.1.1 (X:105-238) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata)}
ggggkpsgellelierdfgsfekfldefkaaaatqfgsgwawlaykaskldadednklvv
ikspnavnplvwggyyplltidvwehayyldfqnrrpdyisvfmdklvswdavssrleqa
kalsa
SCOP Domain Coordinates for d1unfx2:
Click to download the PDB-style file with coordinates for d1unfx2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1unfx2:
- d1unfx2 is new in SCOP 1.71
- d1unfx2 appears in SCOP 1.73
- d1unfx2 appears in the current release, SCOPe 2.08
View in 3D
