Lineage for d1unfx1 (1unf X:14-104)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979785Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1979786Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 protein domains)
  6. 1979814Protein Fe superoxide dismutase (FeSOD) [46611] (10 species)
  7. 1979817Species Cowpea (Vigna unguiculata) [TaxId:3917] [116762] (1 PDB entry)
    Uniprot Q9M7R2 21-245
  8. 1979818Domain d1unfx1: 1unf X:14-104 [113314]
    Other proteins in same PDB: d1unfx2
    complexed with fe

Details for d1unfx1

PDB Entry: 1unf (more details), 1.97 Å

PDB Description: the crystal structure of the eukaryotic fesod from vigna unguiculata suggests a new enzymatic mechanism
PDB Compounds: (X:) iron superoxide dismutase

SCOPe Domain Sequences for d1unfx1:

Sequence, based on SEQRES records: (download)

>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]}
kvnakfelkpppyplnglepvmsqqtlefhwgkhhrtyvenlkkqvvgteldgksleeii
vtaynkgdilpafnnaaqvwnhdffwecmkp

Sequence, based on observed residues (ATOM records): (download)

>d1unfx1 a.2.11.1 (X:14-104) Fe superoxide dismutase (FeSOD) {Cowpea (Vigna unguiculata) [TaxId: 3917]}
kvnakfelkpppyplnglepvmsqqtlefhwgkhhrtyvenlkkqvteldgksleeiivt
aynkgdilpafnnaaqvwnhdffwecmkp

SCOPe Domain Coordinates for d1unfx1:

Click to download the PDB-style file with coordinates for d1unfx1.
(The format of our PDB-style files is described here.)

Timeline for d1unfx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1unfx2