![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.1: Reductases [52344] (5 proteins) |
![]() | Protein cytochrome b5 reductase [52357] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117484] (1 PDB entry) Uniprot P00387 30-300 |
![]() | Domain d1umka2: 1umk A:154-300 [113313] Other proteins in same PDB: d1umka1 complexed with fad |
PDB Entry: 1umk (more details), 1.75 Å
SCOPe Domain Sequences for d1umka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} gkfairpdkksnpiirtvksvgmiaggtgitpmlqviraimkdpddhtvchllfanqtek dillrpeleelrnkhsarfklwytldrapeawdygqgfvneemirdhlpppeeeplvlmc gpppmiqyaclpnldhvghptercfvf
Timeline for d1umka2: