Lineage for d1umka1 (1umk A:30-153)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793531Protein cytochrome b5 reductase [50427] (3 species)
  7. 2793532Species Human (Homo sapiens) [TaxId:9606] [117215] (1 PDB entry)
    Uniprot P00387 30-300
  8. 2793533Domain d1umka1: 1umk A:30-153 [113312]
    Other proteins in same PDB: d1umka2
    complexed with fad

Details for d1umka1

PDB Entry: 1umk (more details), 1.75 Å

PDB Description: The Structure of Human Erythrocyte NADH-cytochrome b5 Reductase
PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d1umka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]}
tpaitlespdikyplrlidreiishdtrrfrfalpspqhilglpvgqhiylsaridgnlv
vrpytpissdddkgfvdlvikvyfkdthpkfpaggkmsqylesmqigdtiefrgpsgllv
yqgk

SCOPe Domain Coordinates for d1umka1:

Click to download the PDB-style file with coordinates for d1umka1.
(The format of our PDB-style files is described here.)

Timeline for d1umka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1umka2