SCOPe 2.08: Domain d1umka1: 1umk A:30-153

Lineage for d1umka1 (1umk A:30-153)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein cytochrome b5 reductase [50427] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117215] (1 PDB entry)
   Uniprot P00387 30-300

8. Domain d1umka1: 1umk A:30-153 [113312]
   Other proteins in same PDB: d1umka2
   complexed with fad

Details for d1umka1

PDB Entry: 1umk, 1.75 Å

PDB Description: The Structure of Human Erythrocyte NADH-cytochrome b5 Reductase

PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d1umka1:

Sequence; same for both SEQRES and ATOM records:

>d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]}
tpaitlespdikyplrlidreiishdtrrfrfalpspqhilglpvgqhiylsaridgnlv
vrpytpissdddkgfvdlvikvyfkdthpkfpaggkmsqylesmqigdtiefrgpsgllv
yqgk

Timeline for d1umka1:

• d1umka1 first appeared in SCOP 1.71
  
• d1umka1 appears in SCOPe 2.07