Lineage for d1umjb_ (1umj B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603695Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 603738Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)
  6. 603739Protein Cut A1 [89931] (4 species)
  7. 603742Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102974] (3 PDB entries)
  8. 603745Domain d1umjb_: 1umj B: [113311]
    Structural genomics target
    complexed with gai

Details for d1umjb_

PDB Entry: 1umj (more details), 1.6 Å

PDB Description: Crystal structure of Pyrococcus horikoshii CutA in the presence of 3M guanidine hydrochloride

SCOP Domain Sequences for d1umjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1umjb_ d.58.5.2 (B:) Cut A1 {Archaeon Pyrococcus horikoshii }
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetk

SCOP Domain Coordinates for d1umjb_:

Click to download the PDB-style file with coordinates for d1umjb_.
(The format of our PDB-style files is described here.)

Timeline for d1umjb_: