SCOPe 2.05: Domain d1umja_: 1umj A:

Lineage for d1umja_ (1umj A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [102974] (6 PDB entries)
   Uniprot O58720

8. Domain d1umja_: 1umj A: [113310]
   Structural genomics target
   complexed with gai

Details for d1umja_

PDB Entry: 1umj, 1.6 Å

PDB Description: Crystal structure of Pyrococcus horikoshii CutA in the presence of 3M guanidine hydrochloride

PDB Compounds: (A:) Periplasmic divalent cation tolerance protein cutA

SCOPe Domain Sequences for d1umja_:

Sequence; same for both SEQRES and ATOM records:

>d1umja_ d.58.5.2 (A:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]}
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetk

Timeline for d1umja_:

• d1umja_ first appeared in SCOP 1.71
  
• d1umja_ appears in SCOPe 2.04
  
• d1umja_ appears in SCOPe 2.06
  
• d1umja_ appears in the current release, SCOPe 2.08