SCOP 1.71: Domain d1umja_: 1umj A:

Lineage for d1umja_ (1umj A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (4 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)

6. Protein Cut A1 [89931] (4 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [102974] (3 PDB entries)

8. Domain d1umja_: 1umj A: [113310]

Details for d1umja_

PDB Entry: 1umj, 1.6 Å

PDB Description: Crystal structure of Pyrococcus horikoshii CutA in the presence of 3M guanidine hydrochloride

SCOP Domain Sequences for d1umja_:

Sequence; same for both SEQRES and ATOM records:

>d1umja_ d.58.5.2 (A:) Cut A1 {Archaeon Pyrococcus horikoshii }
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktred
lweelkerikelhpydvpaiiridvddvnedylkwlieetk

Timeline for d1umja_:

• d1umja_ is new in SCOP 1.71
  
• d1umja_ appears in SCOP 1.73
  
• d1umja_ appears in the current release, SCOPe 2.08