SCOP 1.75: Domain d1um5h1: 1um5 H:3-119

Lineage for d1um5h1 (1um5 H:3-119)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E
   SQ NA # humanized antibody
   Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor
   Uniprot P01750 20-116 #
   HV06_MOUSE Ig heavy chain V region 102 precursor
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1um5h1: 1um5 H:3-119 [113302]
   Other proteins in same PDB: d1um5h2, d1um5l1, d1um5l2
   complexed with ss1

Details for d1um5h1

PDB Entry: 1um5, 1.6 Å

PDB Description: Catalytic Antibody 21H3 with alcohol substrate

PDB Compounds: (H:) Antibody 21H3 H chain

SCOP Domain Sequences for d1um5h1:

Sequence; same for both SEQRES and ATOM records:

>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqqsgpvlvkpggsvkmsckaseytltsylfqwvkqksgqglewigyiypynggtryn
ekfrgkatltsdkssntaylelssltsedsavyycarssmsdpganwgpgtlvtvss

Timeline for d1um5h1:

• d1um5h1 first appeared in SCOP 1.71
  
• d1um5h1 appears in SCOP 1.73
  
• d1um5h1 appears in SCOPe 2.01
  
• d1um5h1 appears in the current release, SCOPe 2.08