Lineage for d1uluc_ (1ulu C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091104Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2091381Species Thermus thermophilus [TaxId:274] [117409] (1 PDB entry)
    Uniprot Q5SLI9
  8. 2091384Domain d1uluc_: 1ulu C: [113294]

Details for d1uluc_

PDB Entry: 1ulu (more details), 2 Å

PDB Description: Crystal structure of tt0143 from Thermus thermophilus HB8
PDB Compounds: (C:) enoyl-acyl carrier protein reductase

SCOPe Domain Sequences for d1uluc_:

Sequence, based on SEQRES records: (download)

>d1uluc_ c.2.1.2 (C:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]}
mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
kgvrvnaisagpvrtvaarsipgftkmydrvaqtaplrrnitqeevgnlglfllsplasg
itgevvyvdagyhimgme

Sequence, based on observed residues (ATOM records): (download)

>d1uluc_ c.2.1.2 (C:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]}
mltvdlsgkkalvmgvtnqrslgfaiaaklkeagaevalsyqaerlrpeaeklaealgga
llfradvtqdeeldalfagvkeafggldylvhaiafapreamegryidtrrqdwllalev
sayslvavarraepllregggivtltyyasekvvpkynvmaiakaaleasvrylayelgp
kgvrvnaisagpvydrvaqtaplrrnitqeevgnlglfllsplasgitgevvyvdagyhi
mgme

SCOPe Domain Coordinates for d1uluc_:

Click to download the PDB-style file with coordinates for d1uluc_.
(The format of our PDB-style files is described here.)

Timeline for d1uluc_: