Lineage for d1ulsc_ (1uls C:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686426Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 686473Species Thermus thermophilus [TaxId:274] [117407] (1 PDB entry)
  8. 686476Domain d1ulsc_: 1uls C: [113286]

Details for d1ulsc_

PDB Entry: 1uls (more details), 2.4 Å

PDB Description: Crystal structure of tt0140 from Thermus thermophilus HB8
PDB Compounds: (C:) putative 3-oxoacyl-acyl carrier protein reductase

SCOP Domain Sequences for d1ulsc_:

Sequence, based on SEQRES records: (download)

>d1ulsc_ c.2.1.2 (C:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]}
mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
ietrmtakvpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrti
gaapa

Sequence, based on observed residues (ATOM records): (download)

>d1ulsc_ c.2.1.2 (C:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]}
mrlkdkavlitgaahgigratlelfakegarlvacdieegplreaaeavgahpvvmdvad
pasvergfaealahlgrldgvvhyagitrdnfhwkmpledwelvlrvnltgsflvakaas
eamreknpgsivltasrvylgnlgqanyaasmagvvgltrtlalelgrwgirvntlapgf
ietpekvrekaiaatplgragkplevayaalfllsdessfitgqvlfvdggrtigaapa

SCOP Domain Coordinates for d1ulsc_:

Click to download the PDB-style file with coordinates for d1ulsc_.
(The format of our PDB-style files is described here.)

Timeline for d1ulsc_: