Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) |
Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
Protein Acylphosphatase [54977] (4 species) |
Species Thermus thermophilus [TaxId:274] [117977] (1 PDB entry) Uniprot Q5SKS6 |
Domain d1ulra_: 1ulr A: [113283] Structural genomics target |
PDB Entry: 1ulr (more details), 1.3 Å
SCOPe Domain Sequences for d1ulra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulra_ d.58.10.1 (A:) Acylphosphatase {Thermus thermophilus [TaxId: 274]} prlvalvkgrvqgvgyrafaqkkalelglsgyaenlpdgrvevvaegpkealelflhhlk qgprlarveavevqwgeeaglkgfhvy
Timeline for d1ulra_: