Lineage for d1ulra_ (1ulr A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196354Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 2196355Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 2196356Protein Acylphosphatase [54977] (4 species)
  7. 2196366Species Thermus thermophilus [TaxId:274] [117977] (1 PDB entry)
    Uniprot Q5SKS6
  8. 2196367Domain d1ulra_: 1ulr A: [113283]
    Structural genomics target

Details for d1ulra_

PDB Entry: 1ulr (more details), 1.3 Å

PDB Description: Crystal structure of tt0497 from Thermus thermophilus HB8
PDB Compounds: (A:) putative acylphosphatase

SCOPe Domain Sequences for d1ulra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulra_ d.58.10.1 (A:) Acylphosphatase {Thermus thermophilus [TaxId: 274]}
prlvalvkgrvqgvgyrafaqkkalelglsgyaenlpdgrvevvaegpkealelflhhlk
qgprlarveavevqwgeeaglkgfhvy

SCOPe Domain Coordinates for d1ulra_:

Click to download the PDB-style file with coordinates for d1ulra_.
(The format of our PDB-style files is described here.)

Timeline for d1ulra_: