Lineage for d1ulra_ (1ulr A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 604320Superfamily d.58.10: Acylphosphatase-like [54975] (1 family) (S)
  5. 604321Family d.58.10.1: Acylphosphatase-like [54976] (3 proteins)
  6. 604322Protein Acylphosphatase [54977] (4 species)
  7. 604332Species Thermus thermophilus [TaxId:274] [117977] (1 PDB entry)
  8. 604333Domain d1ulra_: 1ulr A: [113283]
    Structural genomics target

Details for d1ulra_

PDB Entry: 1ulr (more details), 1.3 Å

PDB Description: Crystal structure of tt0497 from Thermus thermophilus HB8

SCOP Domain Sequences for d1ulra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulra_ d.58.10.1 (A:) Acylphosphatase {Thermus thermophilus}
prlvalvkgrvqgvgyrafaqkkalelglsgyaenlpdgrvevvaegpkealelflhhlk
qgprlarveavevqwgeeaglkgfhvy

SCOP Domain Coordinates for d1ulra_:

Click to download the PDB-style file with coordinates for d1ulra_.
(The format of our PDB-style files is described here.)

Timeline for d1ulra_: