Lineage for d1ulqg1 (1ulq G:2-275)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 593921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 593922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 593923Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 594064Protein Beta-ketoadipyl CoA thiolase [117750] (1 species)
  7. 594065Species Thermus thermophilus [TaxId:274] [117751] (1 PDB entry)
  8. 594078Domain d1ulqg1: 1ulq G:2-275 [113279]

Details for d1ulqg1

PDB Entry: 1ulq (more details), 3 Å

PDB Description: Crystal structure of tt0182 from Thermus thermophilus HB8

SCOP Domain Sequences for d1ulqg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ulqg1 c.95.1.1 (G:2-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus}
peawiveavrtpigkhggalasvrpddllahalsvlvdrsgvpkeevedvyagcanqage
dnrnvarmalllagfpvevagctvnrlcgsgleavaqaaraiwagegkvyigsgvesmsr
apyavpkpergfptgnlvmydttlgwrfvnpkmqalygtesmgetaenlaemygirreeq
drfallshqkavraweegrfqdevvpvpvkrgkeeilveqdegprrdtsleklaalrpvf
reggtvtagnssplndgaaavllvsddyakahgl

SCOP Domain Coordinates for d1ulqg1:

Click to download the PDB-style file with coordinates for d1ulqg1.
(The format of our PDB-style files is described here.)

Timeline for d1ulqg1: