SCOPe 2.05: Domain d1ulqc2: 1ulq C:276-400

Lineage for d1ulqc2 (1ulq C:276-400)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (9 proteins)

6. Protein Beta-ketoadipyl CoA thiolase [117750] (1 species)

7. Species Thermus thermophilus [TaxId:274] [117751] (1 PDB entry)
   Uniprot Q5SJM1

8. Domain d1ulqc2: 1ulq C:276-400 [113272]
   Structural genomics target

Details for d1ulqc2

PDB Entry: 1ulq, 3 Å

PDB Description: Crystal structure of tt0182 from Thermus thermophilus HB8

PDB Compounds: (C:) putative acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d1ulqc2:

Sequence; same for both SEQRES and ATOM records:

>d1ulqc2 c.95.1.1 (C:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]}
rplarvraiavagvpprimgigpvpatrkaleraglsfsdlglielneafaaqalavlre
wslsmedqrlnpnggaialghplgasgarilttlvhemrrrkvqfglatmcigvgqgiav
vvegm

Timeline for d1ulqc2:

• d1ulqc2 first appeared in SCOP 1.71
  
• d1ulqc2 appears in SCOPe 2.04
  
• d1ulqc2 appears in SCOPe 2.06
  
• d1ulqc2 appears in the current release, SCOPe 2.08