Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) |
Family c.95.1.1: Thiolase-related [53902] (8 proteins) |
Protein Beta-ketoadipyl CoA thiolase [117750] (1 species) |
Species Thermus thermophilus [TaxId:274] [117751] (1 PDB entry) |
Domain d1ulqc2: 1ulq C:276-400 [113272] |
PDB Entry: 1ulq (more details), 3 Å
SCOP Domain Sequences for d1ulqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulqc2 c.95.1.1 (C:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus} rplarvraiavagvpprimgigpvpatrkaleraglsfsdlglielneafaaqalavlre wslsmedqrlnpnggaialghplgasgarilttlvhemrrrkvqfglatmcigvgqgiav vvegm
Timeline for d1ulqc2: