![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (6 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (2 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (7 proteins) |
![]() | Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [116882] (1 PDB entry) |
![]() | Domain d1ukwb1: 1ukw B:259-410 [113265] Other proteins in same PDB: d1ukwa2, d1ukwb2 complexed with co, fad |
PDB Entry: 1ukw (more details), 2.4 Å
SCOP Domain Sequences for d1ukwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ukwb1 a.29.3.1 (B:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus} gegfkiamqtlnktripvaagsvgvarraldearkyakereafgepianfqaiqfklvdm ligietarmytyyaawladqglphahasaiakayaseiafeaanqaiqihggygyvrefp vekllrdvklnqiyegtneiqrliiarhilaa
Timeline for d1ukwb1: