Lineage for d1ukwb1 (1ukw B:259-410)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708345Family a.29.3.1: Medium chain acyl-CoA dehydrogenase-like, C-terminal domain [47204] (10 proteins)
  6. 2708386Protein Medium chain acyl-CoA dehydrogenase, C-domain [47207] (3 species)
  7. 2708417Species Thermus thermophilus [TaxId:274] [116882] (1 PDB entry)
    Uniprot Q5SJ70 32-409
  8. 2708419Domain d1ukwb1: 1ukw B:259-410 [113265]
    Other proteins in same PDB: d1ukwa2, d1ukwb2
    complexed with co, fad

Details for d1ukwb1

PDB Entry: 1ukw (more details), 2.4 Å

PDB Description: Crystal structure of medium-chain acyl-CoA dehydrogenase from Thermus thermophilus HB8
PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d1ukwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukwb1 a.29.3.1 (B:259-410) Medium chain acyl-CoA dehydrogenase, C-domain {Thermus thermophilus [TaxId: 274]}
gegfkiamqtlnktripvaagsvgvarraldearkyakereafgepianfqaiqfklvdm
ligietarmytyyaawladqglphahasaiakayaseiafeaanqaiqihggygyvrefp
vekllrdvklnqiyegtneiqrliiarhilaa

SCOPe Domain Coordinates for d1ukwb1:

Click to download the PDB-style file with coordinates for d1ukwb1.
(The format of our PDB-style files is described here.)

Timeline for d1ukwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ukwb2