SCOPe 2.08: Domain d1ukwa2: 1ukw A:32-258

Lineage for d1ukwa2 (1ukw A:32-258)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins)

6. Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (3 species)

7. Species Thermus thermophilus [TaxId:274] [118186] (1 PDB entry)
   Uniprot Q5SJ70 32-409

8. Domain d1ukwa2: 1ukw A:32-258 [113264]
   Other proteins in same PDB: d1ukwa1, d1ukwb1
   complexed with co, fad

Details for d1ukwa2

PDB Entry: 1ukw, 2.4 Å

PDB Description: Crystal structure of medium-chain acyl-CoA dehydrogenase from Thermus thermophilus HB8

PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d1ukwa2:

Sequence; same for both SEQRES and ATOM records:

>d1ukwa2 e.6.1.1 (A:32-258) Medium chain acyl-CoA dehydrogenase, NM domains {Thermus thermophilus [TaxId: 274]}
idfslteeqrqlqalarrfakevilpvaqeydekeevpwpvieklhevgllnaiipeeyg
gmglkmldevivgeelayacmgiytipmasdlgitpvllagteeqkerflrpltekpala
afalsepgngsdaaalktrairqgdhyvlngtkmwisnggeaewvvvfatvnpelrhkgv
valvvergtpgfkaikihgkmgqrasgtyelvfedvkvpvenrlgee

Timeline for d1ukwa2:

• d1ukwa2 first appeared in SCOP 1.71
  
• d1ukwa2 appears in SCOPe 2.07