Lineage for d1ukjc_ (1ukj C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895835Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 2895846Species Pseudomonas putida [TaxId:303] [75271] (15 PDB entries)
    Uniprot P13254
  8. 2895849Domain d1ukjc_: 1ukj C: [113261]
    complexed with so4

Details for d1ukjc_

PDB Entry: 1ukj (more details), 1.8 Å

PDB Description: Detailed structure of L-Methionine-Lyase from Pseudomonas putida
PDB Compounds: (C:) methionine gamma-lyase

SCOPe Domain Sequences for d1ukjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukjc_ c.67.1.3 (C:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
peerahygiseglvrlsvglediddlladvqqalkasa

SCOPe Domain Coordinates for d1ukjc_:

Click to download the PDB-style file with coordinates for d1ukjc_.
(The format of our PDB-style files is described here.)

Timeline for d1ukjc_: