Lineage for d1ukjb_ (1ukj B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589415Family c.67.1.3: Cystathionine synthase-like [53402] (14 proteins)
  6. 589531Protein Methionine gamma-lyase, MGL [64126] (3 species)
  7. 589532Species Pseudomonas putida [TaxId:303] [75271] (4 PDB entries)
  8. 589538Domain d1ukjb_: 1ukj B: [113260]

Details for d1ukjb_

PDB Entry: 1ukj (more details), 1.8 Å

PDB Description: Detailed structure of L-Methionine-Lyase from Pseudomonas putida

SCOP Domain Sequences for d1ukjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ukjb_ c.67.1.3 (B:) Methionine gamma-lyase, MGL {Pseudomonas putida}
mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
peerahygiseglvrlsvglediddlladvqqalkasa

SCOP Domain Coordinates for d1ukjb_:

Click to download the PDB-style file with coordinates for d1ukjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ukjb_: