Lineage for d1uila_ (1uil A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722459Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 722460Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
    Pfam PF00035
  6. 722461Protein ATP-dependent RNA helicase A, Dhx9 [117901] (1 species)
    formerly hypothetical protein bab28848
  7. 722462Species Mouse (Mus musculus) [TaxId:10090] [117902] (2 PDB entries)
  8. 722463Domain d1uila_: 1uil A: [113255]
    Structural genomics target; 2nd dsRDB

Details for d1uila_

PDB Entry: 1uil (more details)

PDB Description: Double-stranded RNA-binding motif of Hypothetical protein BAB28848
PDB Compounds: (A:) Double-stranded RNA-binding motif

SCOP Domain Sequences for d1uila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgleseevdlnaglhgnwtlenakarlnqyfqkekiqgeykytqvgpdhnrsfia
emtiyikqlgrrifarehgsnkklaaqscalslvrqlyhlgvieayssgpssg

SCOP Domain Coordinates for d1uila_:

Click to download the PDB-style file with coordinates for d1uila_.
(The format of our PDB-style files is described here.)

Timeline for d1uila_: