Lineage for d1uila_ (1uil A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602557Fold d.50: dsRBD-like [54767] (4 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 602558Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 602559Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (7 proteins)
    Pfam 00035
  6. 602560Protein ATP-dependent RNA helicase A, Dhx9 [117901] (1 species)
    formerly hypothetical protein bab28848
  7. 602561Species Mouse (Mus musculus) [TaxId:10090] [117902] (2 PDB entries)
  8. 602563Domain d1uila_: 1uil A: [113255]
    Structural genomics target; 2nd dsRDB

Details for d1uila_

PDB Entry: 1uil (more details)

PDB Description: double-stranded rna-binding motif of hypothetical protein bab28848

SCOP Domain Sequences for d1uila_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus)}
gssgssgleseevdlnaglhgnwtlenakarlnqyfqkekiqgeykytqvgpdhnrsfia
emtiyikqlgrrifarehgsnkklaaqscalslvrqlyhlgvieayssgpssg

SCOP Domain Coordinates for d1uila_:

Click to download the PDB-style file with coordinates for d1uila_.
(The format of our PDB-style files is described here.)

Timeline for d1uila_: