![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Cell division protein kinase 7, CDK7 [118139] (1 species) CMGC group; CDKs subfamily; serine/threonine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118140] (1 PDB entry) |
![]() | Domain d1ua2c_: 1ua2 C: [113253] |
PDB Entry: 1ua2 (more details), 3.02 Å
SCOP Domain Sequences for d1ua2c_:
Sequence, based on SEQRES records: (download)
>d1ua2c_ d.144.1.7 (C:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} ekldflgegqfatvykardkntnqivaikkiklghrseakdginrtalreikllqelshp niiglldafghksnislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhw ilhrdlkpnnllldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygv gvdmwavgcilaelllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksf pgiplhhifsaagddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn
>d1ua2c_ d.144.1.7 (C:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} ekldflgegqfatvykardkntnqivaikkinrtalreikllqelshpniiglldafghk snislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhwilhrdlkpnnll ldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygvgvdmwavgcila elllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksfpgiplhhifsaa gddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn
Timeline for d1ua2c_: