Lineage for d1ua2c_ (1ua2 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611837Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 611838Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 611879Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 612015Protein Cell division protein kinase 7, CDK7 [118139] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 612016Species Human (Homo sapiens) [TaxId:9606] [118140] (1 PDB entry)
  8. 612019Domain d1ua2c_: 1ua2 C: [113253]

Details for d1ua2c_

PDB Entry: 1ua2 (more details), 3.02 Å

PDB Description: crystal structure of human cdk7

SCOP Domain Sequences for d1ua2c_:

Sequence, based on SEQRES records: (download)

>d1ua2c_ d.144.1.7 (C:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens)}
ekldflgegqfatvykardkntnqivaikkiklghrseakdginrtalreikllqelshp
niiglldafghksnislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhw
ilhrdlkpnnllldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygv
gvdmwavgcilaelllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksf
pgiplhhifsaagddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn

Sequence, based on observed residues (ATOM records): (download)

>d1ua2c_ d.144.1.7 (C:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens)}
ekldflgegqfatvykardkntnqivaikkinrtalreikllqelshpniiglldafghk
snislvfdfmetdleviikdnslvltpshikaymlmtlqgleylhqhwilhrdlkpnnll
ldengvlkladfglaksfgspnraythqvvtrwyrapellfgarmygvgvdmwavgcila
elllrvpflpgdsdldqltrifetlgtpteeqwpdmcslpdyvtfksfpgiplhhifsaa
gddlldliqglflfnpcaritatqalkmkyfsnrpgptpgcqlprpn

SCOP Domain Coordinates for d1ua2c_:

Click to download the PDB-style file with coordinates for d1ua2c_.
(The format of our PDB-style files is described here.)

Timeline for d1ua2c_: