SCOPe 2.08: Domain d1u9oa2: 1u9o A:95-215

Lineage for d1u9oa2 (1u9o A:95-215)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
   Uniprot P96222 22-215

8. Domain d1u9oa2: 1u9o A:95-215 [113249]
   Other proteins in same PDB: d1u9oa1
   protein/DNA complex; complexed with cns

Details for d1u9oa2

PDB Entry: 1u9o, 3.3 Å

PDB Description: crystal structure of the transcriptional regulator ethr in a ligand bound conformation

PDB Compounds: (A:) Transcriptional repressor EthR

SCOPe Domain Sequences for d1u9oa2:

Sequence; same for both SEQRES and ATOM records:

>d1u9oa2 a.121.1.1 (A:95-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

Timeline for d1u9oa2:

• d1u9oa2 first appeared in SCOP 1.71
  
• d1u9oa2 appears in SCOPe 2.07