SCOP 1.73: Domain d1u9oa1: 1u9o A:22-94

Lineage for d1u9oa1 (1u9o A:22-94)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (17 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (28 proteins)

6. Protein Ethr repressor [109651] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109652] (3 PDB entries)

8. Domain d1u9oa1: 1u9o A:22-94 [113248]
   Other proteins in same PDB: d1u9oa2
   complexed with cns

Details for d1u9oa1

PDB Entry: 1u9o, 3.3 Å

PDB Description: crystal structure of the transcriptional regulator ethr in a ligand bound conformation

PDB Compounds: (A:) Transcriptional repressor EthR

SCOP Domain Sequences for d1u9oa1:

Sequence; same for both SEQRES and ATOM records:

>d1u9oa1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

Timeline for d1u9oa1:

• d1u9oa1 first appeared in SCOP 1.71
  
• d1u9oa1 appears in SCOP 1.75
  
• d1u9oa1 appears in the current release, SCOPe 2.08