Lineage for d1u9oa1 (1u9o A:22-94)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 532781Superfamily a.4.1: Homeodomain-like [46689] (13 families) (S)
    consists only of helices
  5. 533063Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)
  6. 533070Protein Ethr repressor [109651] (1 species)
  7. 533071Species Mycobacterium tuberculosis [TaxId:1773] [109652] (3 PDB entries)
  8. 533074Domain d1u9oa1: 1u9o A:22-94 [113248]
    Other proteins in same PDB: d1u9oa2
    complexed with cns

Details for d1u9oa1

PDB Entry: 1u9o (more details), 3.3 Å

PDB Description: crystal structure of the transcriptional regulator ethr in a ligand bound conformation

SCOP Domain Sequences for d1u9oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9oa1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOP Domain Coordinates for d1u9oa1:

Click to download the PDB-style file with coordinates for d1u9oa1.
(The format of our PDB-style files is described here.)

Timeline for d1u9oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u9oa2