Lineage for d1u9oa1 (1u9o A:22-94)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692217Protein Ethr repressor [109651] (2 species)
  7. 2692218Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
    Uniprot P96222 22-215
  8. 2692262Domain d1u9oa1: 1u9o A:22-94 [113248]
    Other proteins in same PDB: d1u9oa2
    protein/DNA complex; complexed with cns

Details for d1u9oa1

PDB Entry: 1u9o (more details), 3.3 Å

PDB Description: crystal structure of the transcriptional regulator ethr in a ligand bound conformation
PDB Compounds: (A:) Transcriptional repressor EthR

SCOPe Domain Sequences for d1u9oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9oa1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d1u9oa1:

Click to download the PDB-style file with coordinates for d1u9oa1.
(The format of our PDB-style files is described here.)

Timeline for d1u9oa1: