Lineage for d1u9na2 (1u9n A:95-215)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647677Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 647678Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 647679Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins)
  6. 647686Protein Ethr repressor [109978] (1 species)
  7. 647687Species Mycobacterium tuberculosis [TaxId:1773] [109979] (3 PDB entries)
  8. 647689Domain d1u9na2: 1u9n A:95-215 [113247]
    Other proteins in same PDB: d1u9na1
    complexed with cns

Details for d1u9na2

PDB Entry: 1u9n (more details), 2.3 Å

PDB Description: Crystal structure of the transcriptional regulator EthR in a ligand bound conformation opens therapeutic perspectives against tuberculosis and leprosy
PDB Compounds: (A:) Transcriptional repressor EthR

SCOP Domain Sequences for d1u9na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9na2 a.121.1.1 (A:95-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

SCOP Domain Coordinates for d1u9na2:

Click to download the PDB-style file with coordinates for d1u9na2.
(The format of our PDB-style files is described here.)

Timeline for d1u9na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u9na1