SCOP 1.71: Domain d1u9na2: 1u9n A:95-215

Lineage for d1u9na2 (1u9n A:95-215)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)

6. Protein Ethr repressor [109978] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (3 PDB entries)

8. Domain d1u9na2: 1u9n A:95-215 [113247]
   Other proteins in same PDB: d1u9na1
   complexed with cns

Details for d1u9na2

PDB Entry: 1u9n, 2.3 Å

PDB Description: Crystal structure of the transcriptional regulator EthR in a ligand bound conformation opens therapeutic perspectives against tuberculosis and leprosy

SCOP Domain Sequences for d1u9na2:

Sequence; same for both SEQRES and ATOM records:

>d1u9na2 a.121.1.1 (A:95-215) Ethr repressor {Mycobacterium tuberculosis}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

Timeline for d1u9na2:

• d1u9na2 is new in SCOP 1.71
  
• d1u9na2 appears in SCOP 1.73
  
• d1u9na2 appears in the current release, SCOPe 2.08