Lineage for d1u9na1 (1u9n A:22-94)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (21 families) 
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) 
Protein Ethr repressor [109651] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
Uniprot P96222 22-215
Domain d1u9na1: 1u9n A:22-94 [113246]
Other proteins in same PDB: d1u9na2
protein/DNA complex; complexed with cns
Details for d1u9na1
PDB Entry: 1u9n (more details), 2.3 Å
PDB Description: Crystal structure of the transcriptional regulator EthR in a ligand bound conformation opens therapeutic perspectives against tuberculosis and leprosy
PDB Compounds: (A:) Transcriptional repressor EthRSCOPe Domain Sequences for d1u9na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9na1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp
SCOPe Domain Coordinates for d1u9na1:
Click to download the PDB-style file with coordinates for d1u9na1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1u9na1:
- d1u9na1 first appeared in SCOP 1.71
- d1u9na1 appears in SCOPe 2.07
View in 3D
