Lineage for d1u9kb_ (1u9k B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 548284Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species)
  7. 548292Species Mouse (Mus musculus) [TaxId:10090] [117037] (1 PDB entry)
  8. 548294Domain d1u9kb_: 1u9k B: [113245]
    complexed with zn

Details for d1u9kb_

PDB Entry: 1u9k (more details), 1.76 Å

PDB Description: Crystal Structure of Mouse Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) at 1.76

SCOP Domain Sequences for d1u9kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9kb_ b.1.1.1 (B:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus)}
eeerydlvegqtltvkcpfnimkyansqkawqrlpdgkepltlvvtqrpftrpsevhmgk
ftlkhdpseamlqvqmtdlqvtdsglyrcviyhppndpvvlfhpvrlvvt

SCOP Domain Coordinates for d1u9kb_:

Click to download the PDB-style file with coordinates for d1u9kb_.
(The format of our PDB-style files is described here.)

Timeline for d1u9kb_: