Lineage for d1u9ja_ (1u9j A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820550Protein Polymyxin resistance protein ArnA (PrmI) [117419] (1 species)
    evolved new activities: UDP-glucuronic acid decarboxylase, UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  7. 820551Species Escherichia coli [TaxId:562] [117420] (7 PDB entries)
    Uniprot P77398
  8. 820555Domain d1u9ja_: 1u9j A: [113243]
    complexed with so4

Details for d1u9ja_

PDB Entry: 1u9j (more details), 2.4 Å

PDB Description: Crystal Structure of E. coli ArnA (PmrI) Decarboxylase Domain
PDB Compounds: (A:) Hypothetical protein yfbG

SCOP Domain Sequences for d1u9ja_:

Sequence, based on SEQRES records: (download)

>d1u9ja_ c.2.1.2 (A:) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}
rtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihse
wieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstse
vygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwm
gprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriiena
gnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesssyygkgyq
dvehrkpsirnahrcldwepkidmqetidetldfflrtvdlt

Sequence, based on observed residues (ATOM records): (download)

>d1u9ja_ c.2.1.2 (A:) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]}
rtrvlilgvngfignhlterllredhyevygldigsdaisrflnhphfhfvegdisihse
wieyhvkkcdvvlplvaiatpieytrnplrvfeldfeenlriirycvkyrkriifpstse
vygmcsdkyfdedhsnlivgpvnkprwiysvskqlldrviwaygekeglqftlfrpfnwm
gprldnlnaarigssraitqlilnlvegspiklidggkqkrcftdirdgiealyriiena
gnrcdgeiinignpeneasieelgemllasfekhplrhhfppfagfrvvesvehrkpsir
nahrcldwepkidmqetidetldfflrtvdlt

SCOP Domain Coordinates for d1u9ja_:

Click to download the PDB-style file with coordinates for d1u9ja_.
(The format of our PDB-style files is described here.)

Timeline for d1u9ja_: