SCOPe 2.07: Domain d1u9ca_: 1u9c A:

Lineage for d1u9ca_ (1u9c A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein GK2698 ortholog [117481] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [117482] (1 PDB entry)
   Uniprot Q5KWF3; 96% sequence identity; Geobacillus kaustophilus TaxID: 1462

8. Domain d1u9ca_: 1u9c A: [113234]
   Structural genomics target; APC35852

Details for d1u9ca_

PDB Entry: 1u9c, 1.35 Å

PDB Description: Crystallographic structure of APC35852

PDB Compounds: (A:) apc35852

SCOPe Domain Sequences for d1u9ca_:

Sequence; same for both SEQRES and ATOM records:

>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]}
mskrvlmvvtnhttitddhktglwleefavpylvfqekgydvkvasiqggevpldprsin
ekdpswaeaeaalkhtarlskddahgfdaiflpgghgtmfdfpdnetlqyvlqqfaedgr
iiaavchgpsglvnatykdgtpivkgktvtsftdeeerevgldvhmpfllestlrlrgan
fvrggkwtdfsvrdgnlitgqnpqssrstaekvvaaleere

Timeline for d1u9ca_:

• d1u9ca_ first appeared in SCOP 1.71
  
• d1u9ca_ appears in SCOPe 2.06
  
• d1u9ca_ appears in the current release, SCOPe 2.08