![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
![]() | Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
![]() | Protein GK2698 ortholog [117481] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [117482] (1 PDB entry) |
![]() | Domain d1u9ca_: 1u9c A: [113234] Structural genomics target; APC35852 |
PDB Entry: 1u9c (more details), 1.35 Å
SCOP Domain Sequences for d1u9ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} mskrvlmvvtnhttitddhktglwleefavpylvfqekgydvkvasiqggevpldprsin ekdpswaeaeaalkhtarlskddahgfdaiflpgghgtmfdfpdnetlqyvlqqfaedgr iiaavchgpsglvnatykdgtpivkgktvtsftdeeerevgldvhmpfllestlrlrgan fvrggkwtdfsvrdgnlitgqnpqssrstaekvvaaleere
Timeline for d1u9ca_: