Lineage for d1u9ca_ (1u9c A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 692818Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 692937Family c.23.16.2: DJ-1/PfpI [52325] (9 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 692960Protein GK2698 ortholog [117481] (1 species)
  7. 692961Species Bacillus stearothermophilus [TaxId:1422] [117482] (1 PDB entry)
  8. 692962Domain d1u9ca_: 1u9c A: [113234]
    Structural genomics target; APC35852

Details for d1u9ca_

PDB Entry: 1u9c (more details), 1.35 Å

PDB Description: Crystallographic structure of APC35852
PDB Compounds: (A:) apc35852

SCOP Domain Sequences for d1u9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]}
mskrvlmvvtnhttitddhktglwleefavpylvfqekgydvkvasiqggevpldprsin
ekdpswaeaeaalkhtarlskddahgfdaiflpgghgtmfdfpdnetlqyvlqqfaedgr
iiaavchgpsglvnatykdgtpivkgktvtsftdeeerevgldvhmpfllestlrlrgan
fvrggkwtdfsvrdgnlitgqnpqssrstaekvvaaleere

SCOP Domain Coordinates for d1u9ca_:

Click to download the PDB-style file with coordinates for d1u9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1u9ca_: