Lineage for d1u96a_ (1u96 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534990Fold a.17: Cysteine alpha-hairpin motif [47071] (1 superfamily)
    core: alpha-hairpin crosslinked with two disulfides
  4. 534991Superfamily a.17.1: Cysteine alpha-hairpin motif [47072] (2 families) (S)
  5. 534997Family a.17.1.2: COX17-like [117033] (1 protein)
    Pfam 05051
  6. 534998Protein Cytochrome C oxidase copper chaperone, COX17 [117034] (1 species)
  7. 534999Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117035] (2 PDB entries)
  8. 535001Domain d1u96a_: 1u96 A: [113232]
    complexed with cu

Details for d1u96a_

PDB Entry: 1u96 (more details)

PDB Description: solution structure of yeast cox17 with copper bound

SCOP Domain Sequences for d1u96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u96a_ a.17.1.2 (A:) Cytochrome C oxidase copper chaperone, COX17 {Baker's yeast (Saccharomyces cerevisiae)}
mtetdkkqeqenhaecedkpkpccvckpekeerdtcilfngqdsekckefiekykecmkg
ygfevpsan

SCOP Domain Coordinates for d1u96a_:

Click to download the PDB-style file with coordinates for d1u96a_.
(The format of our PDB-style files is described here.)

Timeline for d1u96a_: