![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.17: Cysteine alpha-hairpin motif [47071] (1 superfamily) core: alpha-hairpin crosslinked with two disulfides |
![]() | Superfamily a.17.1: Cysteine alpha-hairpin motif [47072] (2 families) ![]() |
![]() | Family a.17.1.2: COX17-like [117033] (2 proteins) Pfam PF05051 |
![]() | Protein Cytochrome C oxidase copper chaperone, COX17 [117034] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117035] (2 PDB entries) Uniprot Q12287 |
![]() | Domain d1u96a_: 1u96 A: [113232] complexed with cu1 |
PDB Entry: 1u96 (more details)
SCOPe Domain Sequences for d1u96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u96a_ a.17.1.2 (A:) Cytochrome C oxidase copper chaperone, COX17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mtetdkkqeqenhaecedkpkpccvckpekeerdtcilfngqdsekckefiekykecmkg ygfevpsan
Timeline for d1u96a_: