Lineage for d1u96a_ (1u96 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697851Fold a.17: Cysteine alpha-hairpin motif [47071] (1 superfamily)
    core: alpha-hairpin crosslinked with two disulfides
  4. 2697852Superfamily a.17.1: Cysteine alpha-hairpin motif [47072] (2 families) (S)
  5. 2697858Family a.17.1.2: COX17-like [117033] (2 proteins)
    Pfam PF05051
  6. 2697859Protein Cytochrome C oxidase copper chaperone, COX17 [117034] (1 species)
  7. 2697860Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117035] (2 PDB entries)
    Uniprot Q12287
  8. 2697861Domain d1u96a_: 1u96 A: [113232]
    complexed with cu1

Details for d1u96a_

PDB Entry: 1u96 (more details)

PDB Description: solution structure of yeast cox17 with copper bound
PDB Compounds: (A:) Cytochrome c oxidase copper chaperone

SCOPe Domain Sequences for d1u96a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u96a_ a.17.1.2 (A:) Cytochrome C oxidase copper chaperone, COX17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtetdkkqeqenhaecedkpkpccvckpekeerdtcilfngqdsekckefiekykecmkg
ygfevpsan

SCOPe Domain Coordinates for d1u96a_:

Click to download the PDB-style file with coordinates for d1u96a_.
(The format of our PDB-style files is described here.)

Timeline for d1u96a_: